PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00182.1.g00450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 411aa    MW: 44714.9 Da    PI: 9.8768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00182.1.g00450.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-17114161148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc00182.1.g00450.1.am.mk 114 KGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLQRCGKSCRLRWINYL 161
                                   79********************************************97 PP

2Myb_DNA-binding551.9e-17167211147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++T eEd+l++++++ lG++ W+ Ia +++ gRt++++k++w+++
  Zmw_sc00182.1.g00450.1.am.mk 167 RGNFTDEEDDLIIKLHQVLGNK-WSMIAGRLP-GRTDNEIKNYWNTH 211
                                   89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-24105164IPR009057Homeodomain-like
PROSITE profilePS5129417.526109161IPR017930Myb domain
SMARTSM007174.4E-13113163IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-30113208IPR009057Homeodomain-like
PfamPF002495.8E-15114161IPR001005SANT/Myb domain
CDDcd001674.89E-11116161No hitNo description
PROSITE profilePS5129427.775162216IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-27165216IPR009057Homeodomain-like
SMARTSM007172.0E-16166214IPR001005SANT/Myb domain
PfamPF002495.4E-15167211IPR001005SANT/Myb domain
CDDcd001672.83E-12169212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MDRAVAVDCG ENNSSHGMAA ADIEGPRCAA YRMQVALACL RTCVTNRARA PSLDLARARE  60
GGELVAIGLI VNITQLTYHS SRPCRSSKKL RSGQPLMMET MGRSPCCEKA HTNKGAWTKE  120
EDQRLVAYIK AHGEGCWRSL PKAAGLQRCG KSCRLRWINY LRPDLKRGNF TDEEDDLIIK  180
LHQVLGNKWS MIAGRLPGRT DNEIKNYWNT HIKRKLLARG IDPKTHRPLS EAATAAASSS  240
THLQDHPARP SSSPETSCCA GQSGDEGSAS GSLPETSTQR QLASCIIDLN LSIGPPQHQP  300
SSSPPPPPTR PEAQAAGSST TATAGTSSSS NSEKERICLR HTTVSCCSTP GHRPSCRRVT  360
ICPSAMPLWP KRPDPHRPVR PDPRLHIAAL RERLRALPVA APLPRWRAGP S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-301142167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977235.11e-101PREDICTED: myb-related protein Zm38-like
TrEMBLK3YEC21e-101K3YEC2_SETIT; Uncharacterized protein
STRINGSi012585m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448